(data stored in ACNUC7421 zone)

EMBL: CP001111.PE384

CP001111.PE384       Location/Qualifiers
FT   CDS             462510..463577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0384"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_3104 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50089"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHP6"
FT                   /protein_id="ACF50089.1"
FT                   /translation="MDKPRYAVEIIIAAPGTPLIDKKTGSQEVIDGVPQTSGPGHMFYV
FT                   LRAPGQQPQSYGFAPIEHGSVNGQGKVMNDDATIYKDPHYSRTLEISEEQYRKLEAFGT
FT                   YPSKYGFDLQYKDVRHNCVDFTWEALNHAGIERKRSIDVNALGGGIGQLLPDVRIPLES
FT                   KGAGKDGFRPLRNIHGVDSIDPPFPDSELNQKKTNPLPARSFQQRILSDAEGVGERSGD
FT                   HLARHGNDLLLSQIHQGVALLDAERGRAFDATSENISASLYALAKANGLTQVDHVLVSD
FT                   RTAQADVAQNIFIVQGERDDPAQLRASMPTAVAAQTPAETSFERAEQLSQSAQSRTQDE
FT                   LQQRQVQEQSGPRMA"
     MDKPRYAVEI IIAAPGTPLI DKKTGSQEVI DGVPQTSGPG HMFYVLRAPG QQPQSYGFAP        60
     IEHGSVNGQG KVMNDDATIY KDPHYSRTLE ISEEQYRKLE AFGTYPSKYG FDLQYKDVRH       120
     NCVDFTWEAL NHAGIERKRS IDVNALGGGI GQLLPDVRIP LESKGAGKDG FRPLRNIHGV       180
     DSIDPPFPDS ELNQKKTNPL PARSFQQRIL SDAEGVGERS GDHLARHGND LLLSQIHQGV       240
     ALLDAERGRA FDATSENISA SLYALAKANG LTQVDHVLVS DRTAQADVAQ NIFIVQGERD       300
     DPAQLRASMP TAVAAQTPAE TSFERAEQLS QSAQSRTQDE LQQRQVQEQS GPRMA            355
//

If you have problems or comments...

PBIL Back to PBIL home page