(data stored in ACNUC7421 zone)

EMBL: CP001111.PE388

CP001111.PE388       Location/Qualifiers
FT   CDS             465764..466714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0388"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: plu:plu4879 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50093"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHQ0"
FT                   /protein_id="ACF50093.1"
FT                   /translation="MATELAFSIEFNDTINAERAYELYWADVITDKRAFLCPEHESGCP
FT                   AKYTCANMDTEQLQLKQVPHFRNQHDSELHMEGCPHVAELDVRGCSGESRPSEVGQPAP
FT                   DRFLLTRPVGHFDVRQGTASETDFGAGGRSGSGEASGTRSRRTQFYSLAALVSRWLKAR
FT                   QDNMDDTMIVSAGTQEPMTYRELFENFFEKRPYLSGNTRVYWSKAWIRKTDDGFKIIFC
FT                   EPITALVGEMLAEPLRPSAMVWNSVLAASEMKSLHARRLQRFAESEAPCVVFLYGTPAL
FT                   QEKHSRTYLNFDVKSLDLVDVQGTDIFDRIRRPQD"
     MATELAFSIE FNDTINAERA YELYWADVIT DKRAFLCPEH ESGCPAKYTC ANMDTEQLQL        60
     KQVPHFRNQH DSELHMEGCP HVAELDVRGC SGESRPSEVG QPAPDRFLLT RPVGHFDVRQ       120
     GTASETDFGA GGRSGSGEAS GTRSRRTQFY SLAALVSRWL KARQDNMDDT MIVSAGTQEP       180
     MTYRELFENF FEKRPYLSGN TRVYWSKAWI RKTDDGFKII FCEPITALVG EMLAEPLRPS       240
     AMVWNSVLAA SEMKSLHARR LQRFAESEAP CVVFLYGTPA LQEKHSRTYL NFDVKSLDLV       300
     DVQGTDIFDR IRRPQD                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page