(data stored in ACNUC7421 zone)

EMBL: CP001111.PE389

CP001111.PE389       Location/Qualifiers
FT   CDS             466959..467576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50094"
FT                   /db_xref="GOA:B4SHQ1"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHQ1"
FT                   /protein_id="ACF50094.1"
FT                   /translation="MSDVAMLLDAGLPVAVVAVISGVVLGAKVVQALCAYLRQGRKECL
FT                   ELWDRSKVDDAFWLESYINHRYNVRSPPADLVRACLEAGNSTTMMRDLVMNWRFFQGNS
FT                   LPTLRWRGASRNHPILLWVELAMLPLVYFGFVVLGLLVIDKGGERGIVAAGPLIALGAL
FT                   SFWSFLTLIGARRALSDLRRQDETDERVSLSHPPADKHRALG"
     MSDVAMLLDA GLPVAVVAVI SGVVLGAKVV QALCAYLRQG RKECLELWDR SKVDDAFWLE        60
     SYINHRYNVR SPPADLVRAC LEAGNSTTMM RDLVMNWRFF QGNSLPTLRW RGASRNHPIL       120
     LWVELAMLPL VYFGFVVLGL LVIDKGGERG IVAAGPLIAL GALSFWSFLT LIGARRALSD       180
     LRRQDETDER VSLSHPPADK HRALG                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page