(data stored in ACNUC7421 zone)

EMBL: CP001111.PE392

CP001111.PE392       Location/Qualifiers
FT   CDS             complement(469372..470214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0392"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcv:XCV0651 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50097"
FT                   /db_xref="GOA:B4SHQ4"
FT                   /db_xref="InterPro:IPR008471"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHQ4"
FT                   /protein_id="ACF50097.1"
FT                   /translation="MPHYTGPLLTRDSADNLRRAHDKGAAEWQGSLDLGRSQDSVALNA
FT                   DGFHFRGQAYPWPGKLKDRTLYYWDGEDFAPISRYSGSLIKLVPTEWGAPTFEIDGIKM
FT                   LPTSKLSPFEDARRKVELVAPAGKVILDTCGGLGYFAACALEAGVGQIRSFEKNADVMW
FT                   LRTLNPWSPDPESAAAGGRLRFSHGDVSQQIEQVASNSVDAILHDPPRFGIAGELYSQV
FT                   FYDHLARVIRKGGRLFHYTGAPNKLTSGRDVPREVAKRLEKAGFKAELALDGVLAVKR"
     MPHYTGPLLT RDSADNLRRA HDKGAAEWQG SLDLGRSQDS VALNADGFHF RGQAYPWPGK        60
     LKDRTLYYWD GEDFAPISRY SGSLIKLVPT EWGAPTFEID GIKMLPTSKL SPFEDARRKV       120
     ELVAPAGKVI LDTCGGLGYF AACALEAGVG QIRSFEKNAD VMWLRTLNPW SPDPESAAAG       180
     GRLRFSHGDV SQQIEQVASN SVDAILHDPP RFGIAGELYS QVFYDHLARV IRKGGRLFHY       240
     TGAPNKLTSG RDVPREVAKR LEKAGFKAEL ALDGVLAVKR                             280
//

If you have problems or comments...

PBIL Back to PBIL home page