(data stored in ACNUC7421 zone)

EMBL: CP001111.PE396

CP001111.PE396       Location/Qualifiers
FT   CDS             complement(472323..473297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0396"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG: xcb:XC_4064
FT                   heavy metal transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50101"
FT                   /db_xref="GOA:B4SHQ8"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHQ8"
FT                   /protein_id="ACF50101.1"
FT                   /translation="MQLDALAAARRHEHRFDDGNPLAERNTRRALWLTVAMMLVEIVGG
FT                   WWFNSMAVLADGWHMSSHALALGLSVFAYRCARRYAHDPRFAFGTWKIEILAGYTSAIA
FT                   LLGVAALMAVQSLERLWVPAPIHYNEAIAIAAVGLGVNLLCAWWLHDSPGHAHHHHGHG
FT                   HNHHHGHDHDHHDHSHAHGHDLNLRSAYVHVLADAATSVLAIVALLGGKLLGLTWLDPV
FT                   MGLVGAVLVTVWAIGLLRDSGRILLDAQMDAPVVAEVREVIEQGPWPARLADLHVWQVG
FT                   RGKYAVSASVVTSDASLDADTVRNALAIHEELVHVTVEIHRSA"
     MQLDALAAAR RHEHRFDDGN PLAERNTRRA LWLTVAMMLV EIVGGWWFNS MAVLADGWHM        60
     SSHALALGLS VFAYRCARRY AHDPRFAFGT WKIEILAGYT SAIALLGVAA LMAVQSLERL       120
     WVPAPIHYNE AIAIAAVGLG VNLLCAWWLH DSPGHAHHHH GHGHNHHHGH DHDHHDHSHA       180
     HGHDLNLRSA YVHVLADAAT SVLAIVALLG GKLLGLTWLD PVMGLVGAVL VTVWAIGLLR       240
     DSGRILLDAQ MDAPVVAEVR EVIEQGPWPA RLADLHVWQV GRGKYAVSAS VVTSDASLDA       300
     DTVRNALAIH EELVHVTVEI HRSA                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page