(data stored in ACNUC7421 zone)

EMBL: CP001111.PE399

CP001111.PE399       Location/Qualifiers
FT   CDS             474536..475861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0399"
FT                   /product="cobalamin synthesis protein P47K"
FT                   /note="PFAM: cobalamin synthesis protein P47K; cobalamin
FT                   synthesis CobW domain protein; KEGG: xom:XOO_4133 nitrile
FT                   hydratase activator"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50104"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHR1"
FT                   /protein_id="ACF50104.1"
FT                   /translation="MNTVSRADRRLPVTVLSGFLGAGKTTLLNQILRNREGLRVAVIVN
FT                   DMSEVNIDAQLVREGGAELRRTEETLVEFSNGCICCTLRDDLLQEVRRLADADRYDYLL
FT                   IESTGIGEPMPVAATFAVRDEHGFSLSDIARLDTMVTVVDGSAFLADFGSTLRLAERGQ
FT                   QAGPDDDRGVVDLLCEQVEFADVIVVSKVDQVDDEVLQDTLAVLRGLNRDAKLLLSSFG
FT                   DVPLAELLDTGRFDMERAQRAPGWVKELRGEHTPETEEYGIGSFVYRSRRPFHPARFAR
FT                   ALQSGMPGVIRSKGWFWLANRMDWVGELNTVGAATRTQAAGFWYAARDRVRARLEDTTP
FT                   LLPPTPLPYSDLGWARQQADCWSAPLPGLEEFPDSAAHTAMQRLWHPLWGDRRQELVVI
FT                   GVHMDERAVRAELDACLLNDQELRAGPLLWHQLPQAFPVWKR"
     MNTVSRADRR LPVTVLSGFL GAGKTTLLNQ ILRNREGLRV AVIVNDMSEV NIDAQLVREG        60
     GAELRRTEET LVEFSNGCIC CTLRDDLLQE VRRLADADRY DYLLIESTGI GEPMPVAATF       120
     AVRDEHGFSL SDIARLDTMV TVVDGSAFLA DFGSTLRLAE RGQQAGPDDD RGVVDLLCEQ       180
     VEFADVIVVS KVDQVDDEVL QDTLAVLRGL NRDAKLLLSS FGDVPLAELL DTGRFDMERA       240
     QRAPGWVKEL RGEHTPETEE YGIGSFVYRS RRPFHPARFA RALQSGMPGV IRSKGWFWLA       300
     NRMDWVGELN TVGAATRTQA AGFWYAARDR VRARLEDTTP LLPPTPLPYS DLGWARQQAD       360
     CWSAPLPGLE EFPDSAAHTA MQRLWHPLWG DRRQELVVIG VHMDERAVRA ELDACLLNDQ       420
     ELRAGPLLWH QLPQAFPVWK R                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page