(data stored in ACNUC7421 zone)

EMBL: CP001111.PE4

CP001111.PE4         Location/Qualifiers
FT   CDS             5128..7587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0004"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: xcb:XC_0004 DNA gyrase subunit B; TIGRFAM: DNA
FT                   gyrase, B subunit; PFAM: DNA gyrase subunit B domain
FT                   protein; ATP-binding region ATPase domain protein; TOPRIM
FT                   domain protein; DNA topoisomerase type IIA subunit B region
FT                   2 domain protein; SMART: DNA topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49709"
FT                   /db_xref="GOA:B4SR08"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR08"
FT                   /protein_id="ACF49709.1"
FT                   /translation="MSDEQNTPANNGNYDANSITALEGLEAVRKRPGMYIGDVHDGTGL
FT                   HHMVFEVVDNSIDEALAGHADHVAVTIHADGSVSVSDNGRGIPTGKHEQMSAKLGREVS
FT                   AAEVVMTVLHAGGKFDDNSYKVSGGLHGVGVSVVNALSQKLLVDVFQGGFHYQQEFSNG
FT                   AAVTPLAKLESTTKRGTTVRFWPSTVAFHDNVEYHYDILARRLRELSFLNSGVKIVLAD
FT                   ERGDGRRDDFHYEGGIRSFVEHLAQLKTPLHPNVISVTGEHNNIVVDVALQWTDSYQET
FT                   MYCFTNNIPQKDGGTHLAGFRGALTRVLNNYIEQNGIAKQAKINLTGDDMREGMIAVLS
FT                   VKVPDPSFSSQTKEKLVSSDVRPAVENAFGARLEEFLQENPNEAKAIAGKIVDAARARE
FT                   AARKARDLTRRKGALDIAGLPGKLADCQEKDPALSELFIVEGDSAGGSAKQGRNRKNQA
FT                   VLPLRGKILNVERARFDRMLASDQVGTLITALGTGIGRDEYNPDKLRYHKIIIMTDADV
FT                   DGAHIRTLLLTFFYRQMPELIERGYVYIGLPPLYKIKQGKQELYLKDDPALDSYLASSA
FT                   VENAALVPATGEPGIEGLALEKLLLTYAAAQDSIERNAHRYDRNVLEALVDFVPMDMDS
FT                   LRNAGEGEGLDALAKRLNQGSLGSPRFTLELQEANEQRPAAVLVTRRHMGEELIQVLPL
FT                   SAFESGELRAIHQASSLLHGLVREGAIISRGAKSIEVDTFAKAQNWLLEEAKRGRQIQR
FT                   FKGLGEMNPEQLWDTTVNPETRRLLQVRIEDAVAADQIFSTLMGDVVEPRRDFIEDNAL
FT                   KVANLDI"
     MSDEQNTPAN NGNYDANSIT ALEGLEAVRK RPGMYIGDVH DGTGLHHMVF EVVDNSIDEA        60
     LAGHADHVAV TIHADGSVSV SDNGRGIPTG KHEQMSAKLG REVSAAEVVM TVLHAGGKFD       120
     DNSYKVSGGL HGVGVSVVNA LSQKLLVDVF QGGFHYQQEF SNGAAVTPLA KLESTTKRGT       180
     TVRFWPSTVA FHDNVEYHYD ILARRLRELS FLNSGVKIVL ADERGDGRRD DFHYEGGIRS       240
     FVEHLAQLKT PLHPNVISVT GEHNNIVVDV ALQWTDSYQE TMYCFTNNIP QKDGGTHLAG       300
     FRGALTRVLN NYIEQNGIAK QAKINLTGDD MREGMIAVLS VKVPDPSFSS QTKEKLVSSD       360
     VRPAVENAFG ARLEEFLQEN PNEAKAIAGK IVDAARAREA ARKARDLTRR KGALDIAGLP       420
     GKLADCQEKD PALSELFIVE GDSAGGSAKQ GRNRKNQAVL PLRGKILNVE RARFDRMLAS       480
     DQVGTLITAL GTGIGRDEYN PDKLRYHKII IMTDADVDGA HIRTLLLTFF YRQMPELIER       540
     GYVYIGLPPL YKIKQGKQEL YLKDDPALDS YLASSAVENA ALVPATGEPG IEGLALEKLL       600
     LTYAAAQDSI ERNAHRYDRN VLEALVDFVP MDMDSLRNAG EGEGLDALAK RLNQGSLGSP       660
     RFTLELQEAN EQRPAAVLVT RRHMGEELIQ VLPLSAFESG ELRAIHQASS LLHGLVREGA       720
     IISRGAKSIE VDTFAKAQNW LLEEAKRGRQ IQRFKGLGEM NPEQLWDTTV NPETRRLLQV       780
     RIEDAVAADQ IFSTLMGDVV EPRRDFIEDN ALKVANLDI                              819
//

If you have problems or comments...

PBIL Back to PBIL home page