(data stored in ACNUC7421 zone)

EMBL: CP001111.PE40

CP001111.PE40        Location/Qualifiers
FT   CDS             47282..48484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0040"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slo:Shew_3564 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49745"
FT                   /db_xref="InterPro:IPR031979"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR44"
FT                   /protein_id="ACF49745.1"
FT                   /translation="MTIHSTLLASAVLAVLSLSTAHAAQPLQAARAGDQVPVALVAAPL
FT                   PADESEHAPLAFAWALDPAQPLQAATPYASVSRSYWQQVDGTQLQRGLDLPLTAPDAVI
FT                   QLSPADGARALPANTLQVRDPAGRSSVARSVDARALQDAGMPVSDGSSMLRTGATSAVG
FT                   AYTLQSAQAQGRYVVQVLEPNSPLRLEVQANQAQVLAGGNVQLQARLLEDGATTAQLAS
FT                   RRGGLGGEALLVAPDGRSWPQRLLRTTDGALRAQVRIPADVGTVQGLWELQVFAQADGV
FT                   LRDGKVAFAVARATARFSGQAAPDPASRQVALPLQVAAAGRYEARGTLYATARDGQLKP
FT                   VAQAHAAAWFDGPGAGQLVLPFDQAALPAGFGAPYELRDLQLQDQSRMAPIESRALALR
FT                   F"
     MTIHSTLLAS AVLAVLSLST AHAAQPLQAA RAGDQVPVAL VAAPLPADES EHAPLAFAWA        60
     LDPAQPLQAA TPYASVSRSY WQQVDGTQLQ RGLDLPLTAP DAVIQLSPAD GARALPANTL       120
     QVRDPAGRSS VARSVDARAL QDAGMPVSDG SSMLRTGATS AVGAYTLQSA QAQGRYVVQV       180
     LEPNSPLRLE VQANQAQVLA GGNVQLQARL LEDGATTAQL ASRRGGLGGE ALLVAPDGRS       240
     WPQRLLRTTD GALRAQVRIP ADVGTVQGLW ELQVFAQADG VLRDGKVAFA VARATARFSG       300
     QAAPDPASRQ VALPLQVAAA GRYEARGTLY ATARDGQLKP VAQAHAAAWF DGPGAGQLVL       360
     PFDQAALPAG FGAPYELRDL QLQDQSRMAP IESRALALRF                             400
//

If you have problems or comments...

PBIL Back to PBIL home page