(data stored in ACNUC7421 zone)

EMBL: CP001111.PE400

CP001111.PE400       Location/Qualifiers
FT   CDS             complement(475966..477573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0400"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cti:RALTA_B0293 putative ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50105"
FT                   /db_xref="GOA:B4SHR2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4SHR2"
FT                   /protein_id="ACF50105.1"
FT                   /translation="MTPHSLTLDRVSYRLADGRVLFSDLSFSFEPVATGLVGANGTGKS
FT                   VLARLLAGRLSPDSGQVRGSDRVFLLPTPGYPPAGTVGELAGVGEALSALARIEAGSVD
FT                   EADFTCVGERWDLRERLQQQWQALGLPDDLDHAQPAARLSGGQAMQVALSGAWASGADW
FT                   LILDEPSNHLDARHRQQLYKQLQQWRGGLLAISHDRELLGRMQQIVELDARGLHRYGGA
FT                   WQHYAEVRAAEREAAAAQLDHARAQHRQQQRSAREQNERQQQRQARGNREAKQANQAPI
FT                   LLGRQKQRAEASLGRAQQVQSERLQASAEQLRAAISAVHTAPELALFAGAGERGSTRLL
FT                   QAEALVLPHGCSAPLQLEIRRGQRIAVVGDNGSGKSTLLRVLAGQLRARDGTVQRHAPL
FT                   ALLDQQLLGLSGEHSILDSVQAANPGADPGELRTRLALLGLDAQRIQRPASSLSDGERV
FT                   KGALASVLYADPAPQLLLLDEPGNALDLSALQALEELLAAWPGALMMVSHDLHLLQALR
FT                   PTQVLQVTANSWQWRDSL"
     MTPHSLTLDR VSYRLADGRV LFSDLSFSFE PVATGLVGAN GTGKSVLARL LAGRLSPDSG        60
     QVRGSDRVFL LPTPGYPPAG TVGELAGVGE ALSALARIEA GSVDEADFTC VGERWDLRER       120
     LQQQWQALGL PDDLDHAQPA ARLSGGQAMQ VALSGAWASG ADWLILDEPS NHLDARHRQQ       180
     LYKQLQQWRG GLLAISHDRE LLGRMQQIVE LDARGLHRYG GAWQHYAEVR AAEREAAAAQ       240
     LDHARAQHRQ QQRSAREQNE RQQQRQARGN REAKQANQAP ILLGRQKQRA EASLGRAQQV       300
     QSERLQASAE QLRAAISAVH TAPELALFAG AGERGSTRLL QAEALVLPHG CSAPLQLEIR       360
     RGQRIAVVGD NGSGKSTLLR VLAGQLRARD GTVQRHAPLA LLDQQLLGLS GEHSILDSVQ       420
     AANPGADPGE LRTRLALLGL DAQRIQRPAS SLSDGERVKG ALASVLYADP APQLLLLDEP       480
     GNALDLSALQ ALEELLAAWP GALMMVSHDL HLLQALRPTQ VLQVTANSWQ WRDSL            535
//

If you have problems or comments...

PBIL Back to PBIL home page