(data stored in ACNUC7421 zone)

EMBL: CP001111.PE406

CP001111.PE406       Location/Qualifiers
FT   CDS             485157..485933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0406"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   xfm:Xfasm12_1946 soluble lytic murein transglycosylase
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50111"
FT                   /db_xref="GOA:B4SIA6"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIA6"
FT                   /protein_id="ACF50111.1"
FT                   /translation="MSRHPLLLALLLLPSLWPGLAAARTVYRCVQGNTVSLATAPEPGS
FT                   RCTPKEIDDNAVQAPNLWGNMGVFSGVLYEREQDGALVYSTRNLPGSRVFLKFTVATPP
FT                   GEPAHEGLGKVGKPQLAQHAKQFKAAAKATGVDDAWLRAIAHAESNFDALAVSTKGAQG
FT                   VMQLMPDTAQEYGVSDPFSPQQSIDGGARYMRALLRRYNGDRPLAAAAYNAGIGAVTRY
FT                   KGVPPYAETLAYVDKVMALYARYREAMGIRTEVPAR"
     MSRHPLLLAL LLLPSLWPGL AAARTVYRCV QGNTVSLATA PEPGSRCTPK EIDDNAVQAP        60
     NLWGNMGVFS GVLYEREQDG ALVYSTRNLP GSRVFLKFTV ATPPGEPAHE GLGKVGKPQL       120
     AQHAKQFKAA AKATGVDDAW LRAIAHAESN FDALAVSTKG AQGVMQLMPD TAQEYGVSDP       180
     FSPQQSIDGG ARYMRALLRR YNGDRPLAAA AYNAGIGAVT RYKGVPPYAE TLAYVDKVMA       240
     LYARYREAMG IRTEVPAR                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page