(data stored in ACNUC7421 zone)

EMBL: CP001111.PE407

CP001111.PE407       Location/Qualifiers
FT   CDS             complement(486028..487548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0407"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cak:Caul_4326 tetratricopeptide TPR_4"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50112"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIA7"
FT                   /protein_id="ACF50112.1"
FT                   /translation="MPRVLPLTALLLAALAGSPASASIAVAPQKPSVTSDAVHTAYATR
FT                   WDEAIQQSRSGNTLGALIAMEQLMEDPLLDDFDAEHRGRAAQVAGWTALMQKKPAQARR
FT                   YLQRAQESLPDDAQILLTLVSLELSENQPAPATRYLVQALKHAEGPLPIERQPINYLQY
FT                   RLRDQPQRRMELLQALFDNGWKGGGVEPTGLWLALATLQADNGRGDDIPTTLARINGPA
FT                   EIIRLRSDKRFDRYVDRGDARFDPVQAAQKHLDELRVSGLLDRALDARMAEFSNTLLML
FT                   DRNEEVLALTDGMARAAAEGESPSAAEAEWVAWLLNSRLTALRRLGRTDDALATAKLAA
FT                   RIGALGPDGAEHQFNVGFVLSSLGRLQDATAAVNDMQGLGGYGKAAQALLQFAAARERG
FT                   DAKAMDAARAAILAEGDDARLFHREMLLDEGNLDGAAAVLIEQLRSPVERGETLASLQD
FT                   MRTYPSLPGDVKIDAAWRALKQRADVQAEVTRVGRIERYELVGSATSR"
     MPRVLPLTAL LLAALAGSPA SASIAVAPQK PSVTSDAVHT AYATRWDEAI QQSRSGNTLG        60
     ALIAMEQLME DPLLDDFDAE HRGRAAQVAG WTALMQKKPA QARRYLQRAQ ESLPDDAQIL       120
     LTLVSLELSE NQPAPATRYL VQALKHAEGP LPIERQPINY LQYRLRDQPQ RRMELLQALF       180
     DNGWKGGGVE PTGLWLALAT LQADNGRGDD IPTTLARING PAEIIRLRSD KRFDRYVDRG       240
     DARFDPVQAA QKHLDELRVS GLLDRALDAR MAEFSNTLLM LDRNEEVLAL TDGMARAAAE       300
     GESPSAAEAE WVAWLLNSRL TALRRLGRTD DALATAKLAA RIGALGPDGA EHQFNVGFVL       360
     SSLGRLQDAT AAVNDMQGLG GYGKAAQALL QFAAARERGD AKAMDAARAA ILAEGDDARL       420
     FHREMLLDEG NLDGAAAVLI EQLRSPVERG ETLASLQDMR TYPSLPGDVK IDAAWRALKQ       480
     RADVQAEVTR VGRIERYELV GSATSR                                            506
//

If you have problems or comments...

PBIL Back to PBIL home page