(data stored in ACNUC7421 zone)

EMBL: CP001111.PE409

CP001111.PE409       Location/Qualifiers
FT   CDS             complement(489775..490182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0409"
FT                   /product="DGPFAETKE family protein"
FT                   /note="PFAM: DGPFAETKE family protein; KEGG: xcb:XC_3733
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50114"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIA9"
FT                   /protein_id="ACF50114.1"
FT                   /translation="MQQYLLLIYIEPALLQALPTEEFNALMRDCLAHADKLQAEGTLLA
FT                   AQKLQPVDTAQTLRVRDGHSRVLDGPFAETRELLAGFNLIVARDRDEAMRIARDFPWAR
FT                   FGSIEVRPLEDMDAERERCGAPAAAMAAAVP"
     MQQYLLLIYI EPALLQALPT EEFNALMRDC LAHADKLQAE GTLLAAQKLQ PVDTAQTLRV        60
     RDGHSRVLDG PFAETRELLA GFNLIVARDR DEAMRIARDF PWARFGSIEV RPLEDMDAER       120
     ERCGAPAAAM AAAVP                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page