(data stored in ACNUC7421 zone)

EMBL: CP001111.PE41

CP001111.PE41        Location/Qualifiers
FT   CDS             complement(48628..49479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0041"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: xac:XAC0179 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49746"
FT                   /db_xref="GOA:B4SR45"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR45"
FT                   /protein_id="ACF49746.1"
FT                   /translation="MSSLDPRACAVTVAPSAGELPPLIELDRATVVRGQVKVLHGLSLR
FT                   IAQGQHTALLGPNGCGKSTFIKLITRELYPLAQGDGTVAVKVLGQNRWQVDRLRSQLGI
FT                   VTGDLSSNLSDMPGLTVEQAVLSGFFASYVVPAFREVTADMRARVGETLAMTGALSLRE
FT                   RAYAELSAGETRRVLIARALVNRPQALLLDEPSTGLDLVAREQLVATMRVLAQQGITLV
FT                   LVTHHIEEIIPEIERVVLLRDGRVLADGTRAELLRNEPLSAVFGGAITVVEQEGRLTAY
FT                   AG"
     MSSLDPRACA VTVAPSAGEL PPLIELDRAT VVRGQVKVLH GLSLRIAQGQ HTALLGPNGC        60
     GKSTFIKLIT RELYPLAQGD GTVAVKVLGQ NRWQVDRLRS QLGIVTGDLS SNLSDMPGLT       120
     VEQAVLSGFF ASYVVPAFRE VTADMRARVG ETLAMTGALS LRERAYAELS AGETRRVLIA       180
     RALVNRPQAL LLDEPSTGLD LVAREQLVAT MRVLAQQGIT LVLVTHHIEE IIPEIERVVL       240
     LRDGRVLADG TRAELLRNEP LSAVFGGAIT VVEQEGRLTA YAG                         283
//

If you have problems or comments...

PBIL Back to PBIL home page