(data stored in ACNUC7421 zone)

EMBL: CP001111.PE411

CP001111.PE411       Location/Qualifiers
FT   CDS             491397..491819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0411"
FT                   /product="3-demethylubiquinone-9 3-methyltransferase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; 3-demethylubiquinone-9
FT                   3-methyltransferase; KEGG: rpe:RPE_4736
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50116"
FT                   /db_xref="GOA:B4SIB1"
FT                   /db_xref="InterPro:IPR028973"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIB1"
FT                   /protein_id="ACF50116.1"
FT                   /translation="MKLIPFLGFSGQAHEAMAFYAKALGGQVTSEMKYRDMPPSDGSPG
FT                   CNEMPPETLDHVAHSQLEIGSAIVMAADGPGGGEGGSTTINVDVDSIEEAERVFAALAD
FT                   GGQVQMPIAETFWAHRWGMLIDRYGKPWMVNCMKQP"
     MKLIPFLGFS GQAHEAMAFY AKALGGQVTS EMKYRDMPPS DGSPGCNEMP PETLDHVAHS        60
     QLEIGSAIVM AADGPGGGEG GSTTINVDVD SIEEAERVFA ALADGGQVQM PIAETFWAHR       120
     WGMLIDRYGK PWMVNCMKQP                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page