(data stored in ACNUC7421 zone)

EMBL: CP001111.PE412

CP001111.PE412       Location/Qualifiers
FT   CDS             491854..492264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0412"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: mpt:Mpe_A0020 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50117"
FT                   /db_xref="GOA:B4SIB2"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIB2"
FT                   /protein_id="ACF50117.1"
FT                   /translation="MNAPQPQMIFVNLPVKDLEKSKAFFTALGYSFNPTYTNDDAAGMV
FT                   ISESIYVMLLTQPFFQQFTNKPIADAHTHTEVINALSAPSRKAVDELVDKALAAGGSEP
FT                   QPPRDLGFMYQRGFQDLDGHLWEIAHMDGEPG"
     MNAPQPQMIF VNLPVKDLEK SKAFFTALGY SFNPTYTNDD AAGMVISESI YVMLLTQPFF        60
     QQFTNKPIAD AHTHTEVINA LSAPSRKAVD ELVDKALAAG GSEPQPPRDL GFMYQRGFQD       120
     LDGHLWEIAH MDGEPG                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page