(data stored in ACNUC7421 zone)

EMBL: CP001111.PE413

CP001111.PE413       Location/Qualifiers
FT   CDS             492288..492644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0413"
FT                   /product="protein of unknown function DUF1428"
FT                   /note="PFAM: protein of unknown function DUF1428; KEGG:
FT                   rpe:RPE_4844 protein of unknown function DUF1428"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50118"
FT                   /db_xref="InterPro:IPR009874"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIB3"
FT                   /protein_id="ACF50118.1"
FT                   /translation="MAYVDAYVLPCPQDKVAAYRGLARKAGAVWKDHGALQYMECVADD
FT                   VEPGKSTSFPRAVKAKPGETVIVAFVVFRSRAARDRINAKVMADPRLASLGPKDMPFDT
FT                   KRMFWGGFKPIVEA"
     MAYVDAYVLP CPQDKVAAYR GLARKAGAVW KDHGALQYME CVADDVEPGK STSFPRAVKA        60
     KPGETVIVAF VVFRSRAARD RINAKVMADP RLASLGPKDM PFDTKRMFWG GFKPIVEA         118
//

If you have problems or comments...

PBIL Back to PBIL home page