(data stored in ACNUC7421 zone)

EMBL: CP001111.PE415

CP001111.PE415       Location/Qualifiers
FT   CDS             494060..495256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0415"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_5702 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50120"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIB5"
FT                   /protein_id="ACF50120.1"
FT                   /translation="MYSRTKSASRAFARLLACALCLAVWPMAGQAADKSQQAYWAGFAY
FT                   TADAAAVQATTPHAHAVLEKRGLIPLNQTLGQGLKRRPPANLELIDQPVAMLDGTTSAT
FT                   VLAAALDRELVSVEPIGDQYKVLVEVALQALFFDFRERQVIASYPLTLQRIDVQDYRPD
FT                   NDDIDAIVADLLYGSADTSLSQVLAASLAQARLPDAAVRRLQVGGVTLSDAVRAKLPDP
FT                   KWEAPLRATLAHELSKTLSSNTGVGLLPPASGQAIGGAMAARFADGKVYQLKIPEPDYV
FT                   INLQVDALKNGVIEETPAMKTMLFGAFFTAKVTEPFSGKVYFEQPLRKGATKVVPVTQW
FT                   QVDQWSASYETLLAGFDAFAGAAAKRADSRGWLDEQKPGGRPLQQQTQALQELIKSCR"
     MYSRTKSASR AFARLLACAL CLAVWPMAGQ AADKSQQAYW AGFAYTADAA AVQATTPHAH        60
     AVLEKRGLIP LNQTLGQGLK RRPPANLELI DQPVAMLDGT TSATVLAAAL DRELVSVEPI       120
     GDQYKVLVEV ALQALFFDFR ERQVIASYPL TLQRIDVQDY RPDNDDIDAI VADLLYGSAD       180
     TSLSQVLAAS LAQARLPDAA VRRLQVGGVT LSDAVRAKLP DPKWEAPLRA TLAHELSKTL       240
     SSNTGVGLLP PASGQAIGGA MAARFADGKV YQLKIPEPDY VINLQVDALK NGVIEETPAM       300
     KTMLFGAFFT AKVTEPFSGK VYFEQPLRKG ATKVVPVTQW QVDQWSASYE TLLAGFDAFA       360
     GAAAKRADSR GWLDEQKPGG RPLQQQTQAL QELIKSCR                               398
//

If you have problems or comments...

PBIL Back to PBIL home page