(data stored in ACNUC7421 zone)

EMBL: CP001111.PE416

CP001111.PE416       Location/Qualifiers
FT   CDS             495247..496347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0416"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_5701 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50121"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIB6"
FT                   /protein_id="ACF50121.1"
FT                   /translation="MSLMRTILLILIALVVASPVAAQTASSRGTGSASYGLRLSADTRA
FT                   QALNKAKVNALEAYIAETGAAKLRLFEARRAEFIGEIDRYVLSAVQLSDNEDKKAKTYS
FT                   VTVRAEINTTLLQTKLDAGSAVAGATAAQRSLLTFLFMARSQDTVQSFQDKEYRRVDAS
FT                   SSYSENTREGDSFRGNSVSTNGSINQNGSMSVTSGGSTTQRSDNISWKVANAAEVNTAM
FT                   TGAFSAAGYEVVEAEYVEGESRGLLSIERIRKDFSTGNDLAPATLRDTANGIRAANIPY
FT                   IAVGTLDVGMRDRDPASGNTRVFVTVTGKVLDVTGRFPRTVSSVGPVQFSGTGPNETVA
FT                   RTNALQLAAEKAAQQMINELNVKAVR"
     MSLMRTILLI LIALVVASPV AAQTASSRGT GSASYGLRLS ADTRAQALNK AKVNALEAYI        60
     AETGAAKLRL FEARRAEFIG EIDRYVLSAV QLSDNEDKKA KTYSVTVRAE INTTLLQTKL       120
     DAGSAVAGAT AAQRSLLTFL FMARSQDTVQ SFQDKEYRRV DASSSYSENT REGDSFRGNS       180
     VSTNGSINQN GSMSVTSGGS TTQRSDNISW KVANAAEVNT AMTGAFSAAG YEVVEAEYVE       240
     GESRGLLSIE RIRKDFSTGN DLAPATLRDT ANGIRAANIP YIAVGTLDVG MRDRDPASGN       300
     TRVFVTVTGK VLDVTGRFPR TVSSVGPVQF SGTGPNETVA RTNALQLAAE KAAQQMINEL       360
     NVKAVR                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page