(data stored in ACNUC7421 zone)

EMBL: CP001111.PE417

CP001111.PE417       Location/Qualifiers
FT   CDS             496482..497159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0417"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dac:Daci_1236 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50122"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIB7"
FT                   /protein_id="ACF50122.1"
FT                   /translation="MIRNTALVVAIAAATLSMPAHAQFGKLKDLAGAATGTSSSSASSA
FT                   AAPDEAAQEALVRRFVSSQSHSLQAQTSFARAFGLAEQVQLLEAERQALSSGSVSVDAM
FT                   KKSVSVSEAAQAAINERQAAQPELNAESKQHYAEGLVSLLSSAAEAQKLGGEASSFTAG
FT                   MKNLGATQLATVGRKLAAGAWVAKESPGFIKGLYGSTKSAVTFAKKSKVKVPSNADSML
FT                   DSL"
     MIRNTALVVA IAAATLSMPA HAQFGKLKDL AGAATGTSSS SASSAAAPDE AAQEALVRRF        60
     VSSQSHSLQA QTSFARAFGL AEQVQLLEAE RQALSSGSVS VDAMKKSVSV SEAAQAAINE       120
     RQAAQPELNA ESKQHYAEGL VSLLSSAAEA QKLGGEASSF TAGMKNLGAT QLATVGRKLA       180
     AGAWVAKESP GFIKGLYGST KSAVTFAKKS KVKVPSNADS MLDSL                       225
//

If you have problems or comments...

PBIL Back to PBIL home page