(data stored in ACNUC7421 zone)

EMBL: CP001111.PE420

CP001111.PE420       Location/Qualifiers
FT   CDS             501075..502334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0420"
FT                   /product="signal transduction histidine kinase, LytS"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase internal region; KEGG: xcv:XCV3840
FT                   putative two-component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50125"
FT                   /db_xref="GOA:B4SIC0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIC0"
FT                   /protein_id="ACF50125.1"
FT                   /translation="MIASLSLILRHLLAWAAALFVAGMVWSGIFSGMNDGPGWVFGLLV
FT                   MFLMISALGSAVTHVRRVWLVAGRLDGATLSGRQRRQIELPMDAGHAFAVVEAAVGELP
FT                   RVEEVESSAGSLQVRAYVRRVDLWNGRQPSRWNLPARLAIKRNSVLATVTPGQGTSTVT
FT                   LLFEPDAGWWADLLALDEGSNYENAEAVTRAISRRVADQRRDEQAAAEQTQVEKELSVA
FT                   RLNLLHAQVEPHFLYNSLANAQVLTRTDPARAEQMLGHLIQYLRSSLPQVDESVSTLGV
FT                   ELERTRAYLEILRIRMGARLAVEVQVPTELHEVKLPAMALQTLVENAIKHGLEPKPGGG
FT                   TIWILARGFDDHVTVTVADDGLGFGQGTSGTGIGLKNLRERLRLTCGEQAGVAIVANFP
FT                   SGVAATMTLPQSAKERSHAA"
     MIASLSLILR HLLAWAAALF VAGMVWSGIF SGMNDGPGWV FGLLVMFLMI SALGSAVTHV        60
     RRVWLVAGRL DGATLSGRQR RQIELPMDAG HAFAVVEAAV GELPRVEEVE SSAGSLQVRA       120
     YVRRVDLWNG RQPSRWNLPA RLAIKRNSVL ATVTPGQGTS TVTLLFEPDA GWWADLLALD       180
     EGSNYENAEA VTRAISRRVA DQRRDEQAAA EQTQVEKELS VARLNLLHAQ VEPHFLYNSL       240
     ANAQVLTRTD PARAEQMLGH LIQYLRSSLP QVDESVSTLG VELERTRAYL EILRIRMGAR       300
     LAVEVQVPTE LHEVKLPAMA LQTLVENAIK HGLEPKPGGG TIWILARGFD DHVTVTVADD       360
     GLGFGQGTSG TGIGLKNLRE RLRLTCGEQA GVAIVANFPS GVAATMTLPQ SAKERSHAA        419
//

If you have problems or comments...

PBIL Back to PBIL home page