(data stored in ACNUC7421 zone)

EMBL: CP001111.PE421

CP001111.PE421       Location/Qualifiers
FT   CDS             502324..503094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0421"
FT                   /product="two component transcriptional regulator, LytTR
FT                   family"
FT                   /note="PFAM: response regulator receiver; LytTr DNA-binding
FT                   region; KEGG: xcb:XC_3747 transcriptional regulator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50126"
FT                   /db_xref="GOA:B4SIC1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIC1"
FT                   /protein_id="ACF50126.1"
FT                   /translation="MPLEALIAEDEELLRQSLVEQLGRLWPELKLVAECEDGASALEQL
FT                   AEKQPDIAFLDIRMPGISGIEVARSLSELSPRTQVVFVTAYDQYAIDAFEQGAMDYLLK
FT                   PVSDERLLATRERILSRLPSTRQDDAVLERLLQRLGPSQGSADHPPLAWITASNGRETQ
FT                   LIMLEDVAYFRADNKYTTVVTAAGESLLRTPLRELLEVLDPQHFRQIHRSTIVNMKAVA
FT                   AVSRDDTGRGVLRLRQRAETLVVSQPFMSLFRGM"
     MPLEALIAED EELLRQSLVE QLGRLWPELK LVAECEDGAS ALEQLAEKQP DIAFLDIRMP        60
     GISGIEVARS LSELSPRTQV VFVTAYDQYA IDAFEQGAMD YLLKPVSDER LLATRERILS       120
     RLPSTRQDDA VLERLLQRLG PSQGSADHPP LAWITASNGR ETQLIMLEDV AYFRADNKYT       180
     TVVTAAGESL LRTPLRELLE VLDPQHFRQI HRSTIVNMKA VAAVSRDDTG RGVLRLRQRA       240
     ETLVVSQPFM SLFRGM                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page