(data stored in ACNUC7421 zone)

EMBL: CP001111.PE422

CP001111.PE422       Location/Qualifiers
FT   CDS             503128..503472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0422"
FT                   /product="putative secreted protein"
FT                   /note="KEGG: xcv:XCV3838 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50127"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIC2"
FT                   /protein_id="ACF50127.1"
FT                   /translation="MRSFLLMGLAALALAGCQKSTETAITRTNANGVDTLYSKRTVVDG
FT                   VARFECIASRSGQCHYLVLDPACSPDAVCAKAPIRSFAVAVGETREFSDLPKGFNQCVS
FT                   EERKEQCHRE"
     MRSFLLMGLA ALALAGCQKS TETAITRTNA NGVDTLYSKR TVVDGVARFE CIASRSGQCH        60
     YLVLDPACSP DAVCAKAPIR SFAVAVGETR EFSDLPKGFN QCVSEERKEQ CHRE             114
//

If you have problems or comments...

PBIL Back to PBIL home page