(data stored in ACNUC7421 zone)

EMBL: CP001111.PE423

CP001111.PE423       Location/Qualifiers
FT   CDS             complement(503512..504126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0423"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_3744 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50128"
FT                   /db_xref="GOA:B4SIC3"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIC3"
FT                   /protein_id="ACF50128.1"
FT                   /translation="MIALFKGLGILLRDNELYSSPFDKQVAHWRNLSEQQIRDEVAVLA
FT                   QAKCQWLIASIVGWQAASLLILGLIANYLWRDDFHITFTRVVIVFGSWVSILFVIWFMA
FT                   NMFDRTAGFERWMKAFNSRARISSKADSVEHVAEALDLAEHYPEVLDYKQAVTARRELR
FT                   HEDIRIMTEIGRMKQHSELVGRLNHVGETEHHHELTLQPAY"
     MIALFKGLGI LLRDNELYSS PFDKQVAHWR NLSEQQIRDE VAVLAQAKCQ WLIASIVGWQ        60
     AASLLILGLI ANYLWRDDFH ITFTRVVIVF GSWVSILFVI WFMANMFDRT AGFERWMKAF       120
     NSRARISSKA DSVEHVAEAL DLAEHYPEVL DYKQAVTARR ELRHEDIRIM TEIGRMKQHS       180
     ELVGRLNHVG ETEHHHELTL QPAY                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page