(data stored in ACNUC7421 zone)

EMBL: CP001111.PE425

CP001111.PE425       Location/Qualifiers
FT   CDS             complement(505477..506064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0425"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: eca:ECA1819
FT                   TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50130"
FT                   /db_xref="GOA:B4SIC5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIC5"
FT                   /protein_id="ACF50130.1"
FT                   /translation="MVRRTRAEMEETRATLLATARRVFSEHGYAATSMDDLTAQAGLTR
FT                   GALYHHFGDKKGLLAAVVAQLDAETDLRLQAISDTADDAWEGFVQRCRAYLEMALEPEI
FT                   QRIVLRDARAVLGGASPESQRHCVNSMQRLIEQLITQGAVAPVDAQALASLIYGSLAEA
FT                   AFWIADGEQGDARLRQATAALEMLLRGLKSTE"
     MVRRTRAEME ETRATLLATA RRVFSEHGYA ATSMDDLTAQ AGLTRGALYH HFGDKKGLLA        60
     AVVAQLDAET DLRLQAISDT ADDAWEGFVQ RCRAYLEMAL EPEIQRIVLR DARAVLGGAS       120
     PESQRHCVNS MQRLIEQLIT QGAVAPVDAQ ALASLIYGSL AEAAFWIADG EQGDARLRQA       180
     TAALEMLLRG LKSTE                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page