(data stored in ACNUC7421 zone)

EMBL: CP001111.PE428

CP001111.PE428       Location/Qualifiers
FT   CDS             complement(508713..510824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0428"
FT                   /product="Endothelin-converting enzyme 1"
FT                   /EC_number="3.4.24.71"
FT                   /note="PFAM: peptidase M13 neprilysin; peptidase M13; KEGG:
FT                   xcb:XC_3742 metallopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50133"
FT                   /db_xref="GOA:B4SIC8"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR042089"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIC8"
FT                   /protein_id="ACF50133.1"
FT                   /translation="MSKLRRPTLALAIVASLSLAACDRPAEPAAGTAAPADAAPAAAKP
FT                   MLGSFGFDASGMDRSIAAGDDFFGFANGTWVKNTEIPADRSRFGSFNVIAEKTLADTRA
FT                   ILEGAAGNAQANGDDKLIGDYYAAFMDEAGIEQHGLAPVQPQLKAIEAIADKAGLARTL
FT                   GGDMRADVDLLNATNFYTDRLFGLWVSVDMLQPDRTAPYLVQGGLGMPDRDFYLGGGRM
FT                   AELRKQYQAYIAQMLQLAGVADPAGKAQRILALETKIAQAHATQEETNDVTKGANPWTQ
FT                   ADFNAKAPGMDWNAFLDAAALGKQQDFIVWQPKAVAGLSKLVATEPLDAWKDYLAFHAL
FT                   DRAAAYLPKKFADARFAFHGTALSGTPQQSDRWKRAVDDANHAVGEAIGKRYVEKHFDA
FT                   KTKERADEMAKNIIAAFAKRIDALAWMSPQTKASAKAKVAGLTVGMGYPEKWRDYSGLE
FT                   IRRDDALGNAQRAELFEYQRNIAKLGKPVDHSEWAMLPQTINAMNVPLENRLVFPAAIL
FT                   QPPFFDGAADDAVNYGAIGAVIGHEISHGFDNAGALFDETGKLHNWWTAEDLKQFNAAG
FT                   DALAAQFSSYEPFPGVHVNGKLSLGENIADVAGLGTAYDAYQLSLQGKPAQTLEGFTPD
FT                   QRFFLGFAQAWRSKSREQALRNSLLTDVHAPGQFRALTVRNIDAWYPAFEVKEGQKLYL
FT                   APDKRVKVW"
     MSKLRRPTLA LAIVASLSLA ACDRPAEPAA GTAAPADAAP AAAKPMLGSF GFDASGMDRS        60
     IAAGDDFFGF ANGTWVKNTE IPADRSRFGS FNVIAEKTLA DTRAILEGAA GNAQANGDDK       120
     LIGDYYAAFM DEAGIEQHGL APVQPQLKAI EAIADKAGLA RTLGGDMRAD VDLLNATNFY       180
     TDRLFGLWVS VDMLQPDRTA PYLVQGGLGM PDRDFYLGGG RMAELRKQYQ AYIAQMLQLA       240
     GVADPAGKAQ RILALETKIA QAHATQEETN DVTKGANPWT QADFNAKAPG MDWNAFLDAA       300
     ALGKQQDFIV WQPKAVAGLS KLVATEPLDA WKDYLAFHAL DRAAAYLPKK FADARFAFHG       360
     TALSGTPQQS DRWKRAVDDA NHAVGEAIGK RYVEKHFDAK TKERADEMAK NIIAAFAKRI       420
     DALAWMSPQT KASAKAKVAG LTVGMGYPEK WRDYSGLEIR RDDALGNAQR AELFEYQRNI       480
     AKLGKPVDHS EWAMLPQTIN AMNVPLENRL VFPAAILQPP FFDGAADDAV NYGAIGAVIG       540
     HEISHGFDNA GALFDETGKL HNWWTAEDLK QFNAAGDALA AQFSSYEPFP GVHVNGKLSL       600
     GENIADVAGL GTAYDAYQLS LQGKPAQTLE GFTPDQRFFL GFAQAWRSKS REQALRNSLL       660
     TDVHAPGQFR ALTVRNIDAW YPAFEVKEGQ KLYLAPDKRV KVW                         703
//

If you have problems or comments...

PBIL Back to PBIL home page