(data stored in ACNUC7421 zone)

EMBL: CP001111.PE429

CP001111.PE429       Location/Qualifiers
FT   CDS             511001..514063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0429"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: mms:mma_2307 sensory box/GGDEF family protein;
FT                   TIGRFAM: PAS sensor protein; diguanylate cyclase; PFAM:
FT                   GGDEF domain containing protein; EAL domain protein; PAS
FT                   fold-3 domain protein; PAS fold-4 domain protein; PAS fold
FT                   domain protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50134"
FT                   /db_xref="GOA:B4SIC9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIC9"
FT                   /protein_id="ACF50134.1"
FT                   /translation="MRGGARRQEWRPPAVEVGDVEDSFAHEASRLHKEDRPMPALKRAL
FT                   ARPLRAITWGGVLLGVLLVAGLTTMLANDHHRRLEAAQRQSRALAVGSERLLALELRNL
FT                   ERAMSGIAADAAELFRRVPVQAPALLDAAIGGVLSRHAELHSIVVLDRHGRAITAGKGD
FT                   LNLPLWTDPQRRGQGSALYIGPPQQAGDDGWVVPLALSMADDRWLLARLRCGELQRIIG
FT                   GLDVGPNGLVSISDAEGYMLARVPDPHGTVGRRFDLPRRDLLGKQAVVELGSVPGAVDG
FT                   VPRIITVSTLERSPLAVQVGLADEDVLAPWWPYLQASVAIVLAYIGVLLVLLYAVRRST
FT                   RRQQSMAEELKTGHAELRLAHQVGRVCTWYVDEDAALLRWSPLAREIFGVQTDALPVAD
FT                   FFARVHRDDAARLQHAFDQAFAGSAVLDQVFRLVLPGGEVRWVGARGQRVEVADSERRM
FT                   IGALTDLSERYQAREQMGEAERRFRLLFDRNPAPFWVFDPDTLRFIEVNDAAVRQYGYS
FT                   REEFLAMSILDIRPREGWDEVKGAIAKARVGELQDATVRLHRRKDGSVFEVRAHLSRLD
FT                   FDGQPACLVLAEDVSERLAYERDLAYQARHNPATGLLNVRALTEQLDEHDAGYTIAFVQ
FT                   LRGLQLVADTLGREIGDAVLQSMATRLGGLGARCGTLAFQPAEDFVFAIGAGQDVQRVL
FT                   DDLLQIVSAPMRGKDSLHQFEPRIGVATHVAGDGHSAEQVIGMAAQAAHAARAEGNVVV
FT                   WFDASVTTRLADRLRLAGRIHAAIDNEFQLYFQPIRHAGDGSPAALEALLRWPQADGSF
FT                   IPPNEFIPLCEDTGLILALGRWVIRAAAKAQRRLVDAGWGELPIAVNVSAVQFFNSDLV
FT                   TEFTRAQQDFGLARGALHVELTESSLMRKPAQAMQTMQRLHEQGISVSLDDFGTGYSSM
FT                   SYLQHLPLDILKIDRSFVADVETNPRNASICRALLSLGHSMGLTIIAEGVETPGQLDWL
FT                   AAHGCDQVQGYLLGRPAPLEQIIDALDEVPA"
     MRGGARRQEW RPPAVEVGDV EDSFAHEASR LHKEDRPMPA LKRALARPLR AITWGGVLLG        60
     VLLVAGLTTM LANDHHRRLE AAQRQSRALA VGSERLLALE LRNLERAMSG IAADAAELFR       120
     RVPVQAPALL DAAIGGVLSR HAELHSIVVL DRHGRAITAG KGDLNLPLWT DPQRRGQGSA       180
     LYIGPPQQAG DDGWVVPLAL SMADDRWLLA RLRCGELQRI IGGLDVGPNG LVSISDAEGY       240
     MLARVPDPHG TVGRRFDLPR RDLLGKQAVV ELGSVPGAVD GVPRIITVST LERSPLAVQV       300
     GLADEDVLAP WWPYLQASVA IVLAYIGVLL VLLYAVRRST RRQQSMAEEL KTGHAELRLA       360
     HQVGRVCTWY VDEDAALLRW SPLAREIFGV QTDALPVADF FARVHRDDAA RLQHAFDQAF       420
     AGSAVLDQVF RLVLPGGEVR WVGARGQRVE VADSERRMIG ALTDLSERYQ AREQMGEAER       480
     RFRLLFDRNP APFWVFDPDT LRFIEVNDAA VRQYGYSREE FLAMSILDIR PREGWDEVKG       540
     AIAKARVGEL QDATVRLHRR KDGSVFEVRA HLSRLDFDGQ PACLVLAEDV SERLAYERDL       600
     AYQARHNPAT GLLNVRALTE QLDEHDAGYT IAFVQLRGLQ LVADTLGREI GDAVLQSMAT       660
     RLGGLGARCG TLAFQPAEDF VFAIGAGQDV QRVLDDLLQI VSAPMRGKDS LHQFEPRIGV       720
     ATHVAGDGHS AEQVIGMAAQ AAHAARAEGN VVVWFDASVT TRLADRLRLA GRIHAAIDNE       780
     FQLYFQPIRH AGDGSPAALE ALLRWPQADG SFIPPNEFIP LCEDTGLILA LGRWVIRAAA       840
     KAQRRLVDAG WGELPIAVNV SAVQFFNSDL VTEFTRAQQD FGLARGALHV ELTESSLMRK       900
     PAQAMQTMQR LHEQGISVSL DDFGTGYSSM SYLQHLPLDI LKIDRSFVAD VETNPRNASI       960
     CRALLSLGHS MGLTIIAEGV ETPGQLDWLA AHGCDQVQGY LLGRPAPLEQ IIDALDEVPA      1020
//

If you have problems or comments...

PBIL Back to PBIL home page