(data stored in ACNUC7421 zone)

EMBL: CP001111.PE431

CP001111.PE431       Location/Qualifiers
FT   CDS             515136..515546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0431"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: xac:XAC3707
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50136"
FT                   /db_xref="GOA:B4SID1"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:B4SID1"
FT                   /protein_id="ACF50136.1"
FT                   /translation="MHTTTAPVSPLAPYGATLLRLALGVLFLVHALTKLLVFTPAGTAA
FT                   FFESLGLPGVLGYLTIGVELVITAALLLGIYARWVGLIGVPLLLGTIVTVHGANGFSFA
FT                   NAGGGWEYPAFWALALVVLFLVGDGKWTLRSR"
     MHTTTAPVSP LAPYGATLLR LALGVLFLVH ALTKLLVFTP AGTAAFFESL GLPGVLGYLT        60
     IGVELVITAA LLLGIYARWV GLIGVPLLLG TIVTVHGANG FSFANAGGGW EYPAFWALAL       120
     VVLFLVGDGK WTLRSR                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page