(data stored in ACNUC7421 zone)

EMBL: CP001111.PE432

CP001111.PE432       Location/Qualifiers
FT   CDS             515578..516366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0432"
FT                   /product="Extradiol ring-cleavage dioxygenase class III
FT                   protein subunit B"
FT                   /note="PFAM: Extradiol ring-cleavage dioxygenase class III
FT                   protein subunit B; KEGG: xom:XOO_0607 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50137"
FT                   /db_xref="GOA:B4SID2"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR014436"
FT                   /db_xref="UniProtKB/TrEMBL:B4SID2"
FT                   /protein_id="ACF50137.1"
FT                   /translation="MSRLPSLYISHGSPMTALHPGQVGVRLAELARDLPAPRAIVMASA
FT                   HWLGRQPLVGAHPQPPTIHDFGGFPRALFELQYPAPGDPALAEEVAGRIAAAGLPVALD
FT                   PQRGLDHGAWVPLRLLRPQADIPVVPVSIQPLLGPEHQFALGRALAPLREQGVLLVGSG
FT                   SITHNLHDWGDYQDGKEAPYVRPFIEWVEQRLAANDRQALLDYRRQAPFAERAHPTDEH
FT                   LLPLFFAMGAAGEGGFGARRIDAGIDAGFLAMDLYRFDGA"
     MSRLPSLYIS HGSPMTALHP GQVGVRLAEL ARDLPAPRAI VMASAHWLGR QPLVGAHPQP        60
     PTIHDFGGFP RALFELQYPA PGDPALAEEV AGRIAAAGLP VALDPQRGLD HGAWVPLRLL       120
     RPQADIPVVP VSIQPLLGPE HQFALGRALA PLREQGVLLV GSGSITHNLH DWGDYQDGKE       180
     APYVRPFIEW VEQRLAANDR QALLDYRRQA PFAERAHPTD EHLLPLFFAM GAAGEGGFGA       240
     RRIDAGIDAG FLAMDLYRFD GA                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page