(data stored in ACNUC7421 zone)

EMBL: CP001111.PE435

CP001111.PE435       Location/Qualifiers
FT   CDS             518539..519081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0435"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_3728 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50140"
FT                   /db_xref="UniProtKB/TrEMBL:B4SID5"
FT                   /protein_id="ACF50140.1"
FT                   /translation="MPDNSDYFDFEEDVQDFDEADFEARVWNLLVLINPGDDEQALQQF
FT                   NRWREQLAEQGQPLEADSDWLPALFTAIAWQSGFEVERDDLDSLQSAVNELSARFNVQL
FT                   DWGGDLDDEDFAEELDGVQLMSTAFDRLREHNYTLWSVDAGSDGFTGVMALTRDDDAML
FT                   ALCSLLNVEIRLGSDPF"
     MPDNSDYFDF EEDVQDFDEA DFEARVWNLL VLINPGDDEQ ALQQFNRWRE QLAEQGQPLE        60
     ADSDWLPALF TAIAWQSGFE VERDDLDSLQ SAVNELSARF NVQLDWGGDL DDEDFAEELD       120
     GVQLMSTAFD RLREHNYTLW SVDAGSDGFT GVMALTRDDD AMLALCSLLN VEIRLGSDPF       180
//

If you have problems or comments...

PBIL Back to PBIL home page