(data stored in ACNUC7421 zone)

EMBL: CP001111.PE436

CP001111.PE436       Location/Qualifiers
FT   CDS             complement(519163..519438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0436"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xom:XOO_0622 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50141"
FT                   /db_xref="InterPro:IPR025109"
FT                   /db_xref="UniProtKB/TrEMBL:B4SID6"
FT                   /protein_id="ACF50141.1"
FT                   /translation="MSVYVDDAVHPWRGQRWAHLMADTLTELHAMAAQLGIAPRAFQNK
FT                   ASGAHYDVTADLRAQAIALGARAISRHTDRALVKAVIATARAQYRP"
     MSVYVDDAVH PWRGQRWAHL MADTLTELHA MAAQLGIAPR AFQNKASGAH YDVTADLRAQ        60
     AIALGARAIS RHTDRALVKA VIATARAQYR P                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page