(data stored in ACNUC7421 zone)

EMBL: CP001111.PE44

CP001111.PE44        Location/Qualifiers
FT   CDS             51363..52145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0044"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC3635 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49749"
FT                   /db_xref="UniProtKB/TrEMBL:B4SR48"
FT                   /protein_id="ACF49749.1"
FT                   /translation="MKANPVLLTATLLGGLAFGAPVLADEPPAASEPQQDADAAAVAPA
FT                   PAWEHRVPTSTKLETNADGQPIGDRALRLVQRSTTGKVVAAQAAVSLFAGVIGGRGFSK
FT                   DQLKGTRVDTVPNPAFSSMEQQARAALATYFSAHPGAIPEQSRPVQVTVGDFTLIYKEL
FT                   GNAETEYELRQNVDLGFPYRRKLPTMRLTGGEGAHCRIAEPVSASLEAWQADDYALVRQ
FT                   TAERYAEACVASFVQTLPTLFPDTAPVAIQAPVEGQEV"
     MKANPVLLTA TLLGGLAFGA PVLADEPPAA SEPQQDADAA AVAPAPAWEH RVPTSTKLET        60
     NADGQPIGDR ALRLVQRSTT GKVVAAQAAV SLFAGVIGGR GFSKDQLKGT RVDTVPNPAF       120
     SSMEQQARAA LATYFSAHPG AIPEQSRPVQ VTVGDFTLIY KELGNAETEY ELRQNVDLGF       180
     PYRRKLPTMR LTGGEGAHCR IAEPVSASLE AWQADDYALV RQTAERYAEA CVASFVQTLP       240
     TLFPDTAPVA IQAPVEGQEV                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page