(data stored in ACNUC7421 zone)

EMBL: CP001111.PE441

CP001111.PE441       Location/Qualifiers
FT   CDS             522610..522978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0441"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_3721 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50146"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIE1"
FT                   /protein_id="ACF50146.1"
FT                   /translation="MKPTLSLLLALLPTLALAQVPTGNPTATRSTTTVAPQPVVPPVQP
FT                   ARPQPQVLPSPQPAQPIKSTGPAQIAPVPAPKPSSKVYDRNGRIIPGVRPAGPNRVFDS
FT                   RTGRYYDSVPSGDGQQIR"
     MKPTLSLLLA LLPTLALAQV PTGNPTATRS TTTVAPQPVV PPVQPARPQP QVLPSPQPAQ        60
     PIKSTGPAQI APVPAPKPSS KVYDRNGRII PGVRPAGPNR VFDSRTGRYY DSVPSGDGQQ       120
     IR                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page