(data stored in ACNUC7421 zone)

EMBL: CP001111.PE445

CP001111.PE445       Location/Qualifiers
FT   CDS             525348..526415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0445"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="KEGG: xcb:XC_3718 alanine racemase; TIGRFAM: alanine
FT                   racemase; PFAM: alanine racemase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50150"
FT                   /db_xref="GOA:B4SIE5"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIE5"
FT                   /protein_id="ACF50150.1"
FT                   /translation="MRPARALIDLGALRSNYRLARELGGGKALAIIKADAYGHGAVRCA
FT                   QALEGEADGFGVATIEEALELRQAGIGAPILLLEGIFEASDMALVAEHDFWFAVGSPWQ
FT                   LEALAAFDSPRPLTVWLKLDSGMHRLGLDVDSFRAAHARLSALPQVERVVLMTHLARAD
FT                   ELDSERTHEQAATFARAIDGLEGETSVCNSPALLGWPDVRSDWVRPGLMLYGANPLPDN
FT                   TDLTARLRPVMTMQSKVIAERWIESGEPVGYGARFVSKARTRVGVVALGYADGYPQFAP
FT                   NGTPVLIDGQPGALIGRVSMDMLTVDLTAHPQAGVGSVVELWGNAPTLSELAPRCGVSA
FT                   YQLPCGVKRVARVYM"
     MRPARALIDL GALRSNYRLA RELGGGKALA IIKADAYGHG AVRCAQALEG EADGFGVATI        60
     EEALELRQAG IGAPILLLEG IFEASDMALV AEHDFWFAVG SPWQLEALAA FDSPRPLTVW       120
     LKLDSGMHRL GLDVDSFRAA HARLSALPQV ERVVLMTHLA RADELDSERT HEQAATFARA       180
     IDGLEGETSV CNSPALLGWP DVRSDWVRPG LMLYGANPLP DNTDLTARLR PVMTMQSKVI       240
     AERWIESGEP VGYGARFVSK ARTRVGVVAL GYADGYPQFA PNGTPVLIDG QPGALIGRVS       300
     MDMLTVDLTA HPQAGVGSVV ELWGNAPTLS ELAPRCGVSA YQLPCGVKRV ARVYM            355
//

If you have problems or comments...

PBIL Back to PBIL home page