(data stored in ACNUC7421 zone)

EMBL: CP001111.PE446

CP001111.PE446       Location/Qualifiers
FT   CDS             complement(526518..527081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0446"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC3686 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50151"
FT                   /db_xref="InterPro:IPR021557"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIE6"
FT                   /protein_id="ACF50151.1"
FT                   /translation="MKRSLAIALLAGALVAGGANAAPRTVTDAQAPRTLQADGPVNVKW
FT                   DDPAKFTEIRQSSNRFEAERGDWVQQLARYLQTTAAKPLQPGQTLDVTLVDVKRAGDYE
FT                   PWHGPRGRDIRIMRDIYPPRISLQYTLKDASGRIISEGDARLSDTGYLHNVGLKSDSDP
FT                   LRYEKRLIDDWVKRQLTSQATAAR"
     MKRSLAIALL AGALVAGGAN AAPRTVTDAQ APRTLQADGP VNVKWDDPAK FTEIRQSSNR        60
     FEAERGDWVQ QLARYLQTTA AKPLQPGQTL DVTLVDVKRA GDYEPWHGPR GRDIRIMRDI       120
     YPPRISLQYT LKDASGRIIS EGDARLSDTG YLHNVGLKSD SDPLRYEKRL IDDWVKRQLT       180
     SQATAAR                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page