(data stored in ACNUC7421 zone)

EMBL: CP001111.PE447

CP001111.PE447       Location/Qualifiers
FT   CDS             527326..529314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0447"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: xcv:XCV3804 two-component system sensor
FT                   histidine kinase-response regulator hybrid protein;
FT                   TIGRFAM: PAS sensor protein; PFAM: response regulator
FT                   receiver; ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; PAS fold-3 domain
FT                   protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50152"
FT                   /db_xref="GOA:B4SIE7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIE7"
FT                   /protein_id="ACF50152.1"
FT                   /translation="MMVPAPEPDLHHGVLERINAGFCVIQVLFDGDRAVDYRFIEVNDA
FT                   FERHTGLKDARGQRMSALEPHHEEDWFRIYGEVARSGRPAQFEMEARALGRSFAVDAVR
FT                   VGRPGEDKVGILFFDITARKQMEVELGESEARFSALADGLPMPVWVLDERGHARFVNSA
FT                   FSEFFGGDETRVPEDVWRGLVHPDDASVFEYELQEALKAQRSMHALVRARRADGQWRWL
FT                   EMNARPRFSRMGRFIGLAGSSPDVTERREIELAREELLQSERAARSAAENMARLKDEFL
FT                   ATLSHELRTPLTTILGWSELLLQRVDNTSPLYKGLGVIANSAGAQKRLISDMLDLSSML
FT                   LGKVQLEVEVLDLCGVLGEAIGAQELVAEGKALDVHLQLPDRPSLVLGDATRLQQVFWN
FT                   LLSNAIKFTPAEGRIDVALQADGNHWVITVRDTGDGIAPEFLNHLFSRFRQADGTTTRR
FT                   HGGLGLGLAIVQQLVELHGGTVTAASEGHGHGATFTVRLPQHLPDAERRPLREVISGPI
FT                   LEPVIVEPYPLRGMHVLAVEDQPEVLEYLRRMLEEQGASVSAASSAGEALALLADTGHL
FT                   QYHVMLTDIGMPGMDGYGLVRTLREDMGVDALTLPAVAVTALARADDRRRALASGFQEH
FT                   VAKPYSVAQLVSAVRKVQVPRADSALH"
     MMVPAPEPDL HHGVLERINA GFCVIQVLFD GDRAVDYRFI EVNDAFERHT GLKDARGQRM        60
     SALEPHHEED WFRIYGEVAR SGRPAQFEME ARALGRSFAV DAVRVGRPGE DKVGILFFDI       120
     TARKQMEVEL GESEARFSAL ADGLPMPVWV LDERGHARFV NSAFSEFFGG DETRVPEDVW       180
     RGLVHPDDAS VFEYELQEAL KAQRSMHALV RARRADGQWR WLEMNARPRF SRMGRFIGLA       240
     GSSPDVTERR EIELAREELL QSERAARSAA ENMARLKDEF LATLSHELRT PLTTILGWSE       300
     LLLQRVDNTS PLYKGLGVIA NSAGAQKRLI SDMLDLSSML LGKVQLEVEV LDLCGVLGEA       360
     IGAQELVAEG KALDVHLQLP DRPSLVLGDA TRLQQVFWNL LSNAIKFTPA EGRIDVALQA       420
     DGNHWVITVR DTGDGIAPEF LNHLFSRFRQ ADGTTTRRHG GLGLGLAIVQ QLVELHGGTV       480
     TAASEGHGHG ATFTVRLPQH LPDAERRPLR EVISGPILEP VIVEPYPLRG MHVLAVEDQP       540
     EVLEYLRRML EEQGASVSAA SSAGEALALL ADTGHLQYHV MLTDIGMPGM DGYGLVRTLR       600
     EDMGVDALTL PAVAVTALAR ADDRRRALAS GFQEHVAKPY SVAQLVSAVR KVQVPRADSA       660
     LH                                                                      662
//

If you have problems or comments...

PBIL Back to PBIL home page