(data stored in ACNUC7421 zone)

EMBL: CP001111.PE448

CP001111.PE448       Location/Qualifiers
FT   CDS             529358..529651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0448"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_3713 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50153"
FT                   /db_xref="InterPro:IPR021649"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIE8"
FT                   /protein_id="ACF50153.1"
FT                   /translation="MSRIAPRIHTDPAQIARLEALLPQLEGETQVELTLQDGRRLLGTI
FT                   AVKPTVQQYRNDAGDEGSNGQLRLDDYDTPVQQHHVWLDEIASIRRLPPKAP"
     MSRIAPRIHT DPAQIARLEA LLPQLEGETQ VELTLQDGRR LLGTIAVKPT VQQYRNDAGD        60
     EGSNGQLRLD DYDTPVQQHH VWLDEIASIR RLPPKAP                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page