(data stored in ACNUC7421 zone)

EMBL: CP001111.PE449

CP001111.PE449       Location/Qualifiers
FT   CDS             complement(529737..530000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0449"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_3711 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50154"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIE9"
FT                   /protein_id="ACF50154.1"
FT                   /translation="MRALFVGGVVDNSEMDLEGSHPPVHYPEDTGGGHSRYRLHQVGHG
FT                   ADGSVAYAVYGAPDLADDEVARVAEERAYARRFEATPTLFEH"
     MRALFVGGVV DNSEMDLEGS HPPVHYPEDT GGGHSRYRLH QVGHGADGSV AYAVYGAPDL        60
     ADDEVARVAE ERAYARRFEA TPTLFEH                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page