(data stored in ACNUC7421 zone)

EMBL: CP001111.PE450

CP001111.PE450       Location/Qualifiers
FT   CDS             530159..531229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0450"
FT                   /product="methyltransferase small"
FT                   /note="PFAM: methyltransferase small; Methyltransferase
FT                   type 12; KEGG: xac:XAC3679 ribosomal RNA small subunit
FT                   methyltransferase C"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50155"
FT                   /db_xref="GOA:B4SIF0"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIF0"
FT                   /protein_id="ACF50155.1"
FT                   /translation="MASSDDAPLQTLLLPFSQGALRWPEGPVAFLRARDGWPLREVAGG
FT                   REVHCEQSFAPFAQPLQQAAGWTVSGQLDDEAGKGRYPLVLVLPPRQREEARALFARAL
FT                   ALVAEGGRIVACQSNNEGARSGEGDLKQLTGLGGSLTKNHCRAYWTAPMQGQHDADLAK
FT                   RWSALDAVRPIVGGRFLSRPGVFAWDRIDPASALLAEHLPADLAGRAADLGAGYGYLSR
FT                   ELLERCPEITALDLYEAEQRALALAELNLSPPPRPLPLRFLWRDVTAGIEPDYDVIISN
FT                   PPFHTPSRADRPDIGQRFIAVAAQALRPGGRLYVVANRHLPYEYTLNESFGAVRVVAER
FT                   DGFKLVEAVKGRGKGK"
     MASSDDAPLQ TLLLPFSQGA LRWPEGPVAF LRARDGWPLR EVAGGREVHC EQSFAPFAQP        60
     LQQAAGWTVS GQLDDEAGKG RYPLVLVLPP RQREEARALF ARALALVAEG GRIVACQSNN       120
     EGARSGEGDL KQLTGLGGSL TKNHCRAYWT APMQGQHDAD LAKRWSALDA VRPIVGGRFL       180
     SRPGVFAWDR IDPASALLAE HLPADLAGRA ADLGAGYGYL SRELLERCPE ITALDLYEAE       240
     QRALALAELN LSPPPRPLPL RFLWRDVTAG IEPDYDVIIS NPPFHTPSRA DRPDIGQRFI       300
     AVAAQALRPG GRLYVVANRH LPYEYTLNES FGAVRVVAER DGFKLVEAVK GRGKGK           356
//

If you have problems or comments...

PBIL Back to PBIL home page