(data stored in ACNUC7421 zone)

EMBL: CP001111.PE451

CP001111.PE451       Location/Qualifiers
FT   CDS             531226..531927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0451"
FT                   /product="pseudouridine synthase"
FT                   /note="PFAM: pseudouridine synthase; KEGG: xcb:XC_3709
FT                   ribosomal small subunit pseudouridylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50156"
FT                   /db_xref="GOA:B4SIF1"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIF1"
FT                   /protein_id="ACF50156.1"
FT                   /translation="MKLVKLIANLGYGSRKQVQWMFREGRVTDADGEVLYADDQVPHEA
FT                   VRVDGEPLDPPVGLSIALHKPAGYTCSTKDKGRLIYDLLPPRYRDRDPVLSTVGRLDRD
FT                   TSGLLLLTDDGGLLHRIISPKSKLPKVYEVELSDDLRGDEVALFASGTLMLESEKTPLL
FT                   PAELEVLDARRARLVLHEGRYHQVRRMFAATGNHVQALHRSRVGGLDLQGLDEGQWRQL
FT                   TPTDLDTLFAP"
     MKLVKLIANL GYGSRKQVQW MFREGRVTDA DGEVLYADDQ VPHEAVRVDG EPLDPPVGLS        60
     IALHKPAGYT CSTKDKGRLI YDLLPPRYRD RDPVLSTVGR LDRDTSGLLL LTDDGGLLHR       120
     IISPKSKLPK VYEVELSDDL RGDEVALFAS GTLMLESEKT PLLPAELEVL DARRARLVLH       180
     EGRYHQVRRM FAATGNHVQA LHRSRVGGLD LQGLDEGQWR QLTPTDLDTL FAP              233
//

If you have problems or comments...

PBIL Back to PBIL home page