(data stored in ACNUC7421 zone)

EMBL: CP001111.PE454

CP001111.PE454       Location/Qualifiers
FT   CDS             complement(533943..534458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0454"
FT                   /product="beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabA"
FT                   /EC_number="4.2.1.59"
FT                   /note="KEGG: xcb:XC_3651 3-hydroxydecanoyl-(acyl carrier
FT                   protein) dehydratase; TIGRFAM:
FT                   beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabA;
FT                   PFAM: Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase
FT                   FabA/FabZ"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50159"
FT                   /db_xref="GOA:B4SIF4"
FT                   /db_xref="InterPro:IPR010083"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SIF4"
FT                   /protein_id="ACF50159.1"
FT                   /translation="MTRLHAFNREQLLASARGELFGAAAGRLPNDPMLMFDRITEIRED
FT                   GGPHGKGMVRAELDIRPDLWFFGCHFIGDPVMPGCLGLDAMWQLTGFFLTWLGAPGKGR
FT                   ALGCGEVKFTGQVLPDAKLVRYEIDISRVINRKLVMAQSDARMYVDDREIYSARDLRVG
FT                   LFTETGSF"
     MTRLHAFNRE QLLASARGEL FGAAAGRLPN DPMLMFDRIT EIREDGGPHG KGMVRAELDI        60
     RPDLWFFGCH FIGDPVMPGC LGLDAMWQLT GFFLTWLGAP GKGRALGCGE VKFTGQVLPD       120
     AKLVRYEIDI SRVINRKLVM AQSDARMYVD DREIYSARDL RVGLFTETGS F                171
//

If you have problems or comments...

PBIL Back to PBIL home page