(data stored in ACNUC7421 zone)

EMBL: CP001111.PE456

CP001111.PE456       Location/Qualifiers
FT   CDS             complement(535982..536893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0456"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   pfo:PflO1_4474 beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50161"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIF6"
FT                   /protein_id="ACF50161.1"
FT                   /translation="MRTAALLLPLALAATFTSAPLLAAPATAAPATVTKSQLHLQTFHP
FT                   GPQAMFSVSSVLVEGRHDAILVNAQFGASDARKLVDLIRASGKQLTTIYISHGDPDYYF
FT                   GLATLQDAFPQARIVATAQTVAHIQQTQAGKLAYWGPKMGADVPARIVVPQVLDGDALQ
FT                   LEGQRLPLIGLDGPSPDRTVLWVPTLRAIVGGIPVVAGEHVWMADTQTPKSHADWLQTL
FT                   QRLQALKPKVVVPGHYAPGAALDASALRFTADYIRAFDVEAAKAKDSAALVKAMQSRYP
FT                   KLAGVASLELSAKVAKGEMQWP"
     MRTAALLLPL ALAATFTSAP LLAAPATAAP ATVTKSQLHL QTFHPGPQAM FSVSSVLVEG        60
     RHDAILVNAQ FGASDARKLV DLIRASGKQL TTIYISHGDP DYYFGLATLQ DAFPQARIVA       120
     TAQTVAHIQQ TQAGKLAYWG PKMGADVPAR IVVPQVLDGD ALQLEGQRLP LIGLDGPSPD       180
     RTVLWVPTLR AIVGGIPVVA GEHVWMADTQ TPKSHADWLQ TLQRLQALKP KVVVPGHYAP       240
     GAALDASALR FTADYIRAFD VEAAKAKDSA ALVKAMQSRY PKLAGVASLE LSAKVAKGEM       300
     QWP                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page