(data stored in ACNUC7421 zone)

EMBL: CP001111.PE458

CP001111.PE458       Location/Qualifiers
FT   CDS             537726..538655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0458"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bbr:BB3251 probable LysR-family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50163"
FT                   /db_xref="GOA:B4SIF8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIF8"
FT                   /protein_id="ACF50163.1"
FT                   /translation="MDRLTAMTVFVEVAERGSLTAAAEVLDMSRAMVSRYLAEVEGWLG
FT                   ARLLHRTTRRVSLTGPGEAALARFRQMLAIGEELRGELASDDPEPHGTLRVTASVSFGQ
FT                   SHLARAVAGFVARHPAARIELLLVDRTVNLVEERVDLAVRIARQIDPSLIARRLATCRS
FT                   VLCATPSYLQARGTPTAPEHLAAHNCLTHHYVGKSLWQLHREGRSLSVAVGGNISANEA
FT                   SLLLEAVRAGAGIAMLPTYQVAPFLRSGELIELLPEFSLDELGIHAVYASRRQQPAIMR
FT                   RFLDFLAECFASPAFQDLDWRPPGKENT"
     MDRLTAMTVF VEVAERGSLT AAAEVLDMSR AMVSRYLAEV EGWLGARLLH RTTRRVSLTG        60
     PGEAALARFR QMLAIGEELR GELASDDPEP HGTLRVTASV SFGQSHLARA VAGFVARHPA       120
     ARIELLLVDR TVNLVEERVD LAVRIARQID PSLIARRLAT CRSVLCATPS YLQARGTPTA       180
     PEHLAAHNCL THHYVGKSLW QLHREGRSLS VAVGGNISAN EASLLLEAVR AGAGIAMLPT       240
     YQVAPFLRSG ELIELLPEFS LDELGIHAVY ASRRQQPAIM RRFLDFLAEC FASPAFQDLD       300
     WRPPGKENT                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page