(data stored in ACNUC7421 zone)

EMBL: CP001111.PE46

CP001111.PE46        Location/Qualifiers
FT   CDS             53134..54738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0046"
FT                   /product="periplasmic glucan biosynthesis protein MdoG"
FT                   /note="PFAM: periplasmic glucan biosynthesis protein MdoG;
FT                   KEGG: xcv:XCV4387 glucan biosynthesis protein D"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49751"
FT                   /db_xref="GOA:B4SRN1"
FT                   /db_xref="InterPro:IPR007444"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014438"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR023724"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SRN1"
FT                   /protein_id="ACF49751.1"
FT                   /translation="MQRRDFIRNASLALAAFGLPSLPACAASKSGQMGLRRLGQPQPFD
FT                   FATLKGQARALAQAPYKSHKRVLPGRLEGLDWDQYQSIGYRQDHALWADQPGKFQAKFF
FT                   HLGLYFHSPVRMFDVVDGKAQELAYDGAAFNYGKSGIKDGELPADLGFAGFRLNTRKDT
FT                   DRDFAAFLGASYFRAVGKEGQYGQSARGLAIDTGMGKPEEFPDFIAYYLEQPSADSETI
FT                   VVYGLLDSPSVAGAYRFAITNGDVLLMDIDSALYPRKAIERLGIAPCTSMYQVGENDRR
FT                   MAWDWRPEIHDTDGLSLWTGAGEWIWRPLLNPRNLRFNMFVDRNPRGFGLLQRDRNFDH
FT                   YQDDGVFYEKRPCLWVEPKGEWGEGSVQLVEIPTVDETFDNIVAFWNPKEKPQPGQELL
FT                   VGYRLYWGAEPPARPPLAHCVASRTGLGGVVGKKREYFSWRFAVDFEGGELARLIDKGE
FT                   VEAVVEASRGRVEIVSARPLREINGYRAMFDLVPPEGSTEQIDIRLFLRSGGKTLTETW
FT                   LYQYTPPPAGAPERTLY"
     MQRRDFIRNA SLALAAFGLP SLPACAASKS GQMGLRRLGQ PQPFDFATLK GQARALAQAP        60
     YKSHKRVLPG RLEGLDWDQY QSIGYRQDHA LWADQPGKFQ AKFFHLGLYF HSPVRMFDVV       120
     DGKAQELAYD GAAFNYGKSG IKDGELPADL GFAGFRLNTR KDTDRDFAAF LGASYFRAVG       180
     KEGQYGQSAR GLAIDTGMGK PEEFPDFIAY YLEQPSADSE TIVVYGLLDS PSVAGAYRFA       240
     ITNGDVLLMD IDSALYPRKA IERLGIAPCT SMYQVGENDR RMAWDWRPEI HDTDGLSLWT       300
     GAGEWIWRPL LNPRNLRFNM FVDRNPRGFG LLQRDRNFDH YQDDGVFYEK RPCLWVEPKG       360
     EWGEGSVQLV EIPTVDETFD NIVAFWNPKE KPQPGQELLV GYRLYWGAEP PARPPLAHCV       420
     ASRTGLGGVV GKKREYFSWR FAVDFEGGEL ARLIDKGEVE AVVEASRGRV EIVSARPLRE       480
     INGYRAMFDL VPPEGSTEQI DIRLFLRSGG KTLTETWLYQ YTPPPAGAPE RTLY             534
//

If you have problems or comments...

PBIL Back to PBIL home page