(data stored in ACNUC7421 zone)

EMBL: CP001111.PE460

CP001111.PE460       Location/Qualifiers
FT   CDS             539475..540164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0460"
FT                   /product="phosphoglycolate phosphatase"
FT                   /note="TIGRFAM: phosphoglycolate phosphatase;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 3;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 1; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   xcc:XCC0584 phosphoglycolate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50165"
FT                   /db_xref="GOA:B4SIG0"
FT                   /db_xref="InterPro:IPR006346"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR037512"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIG0"
FT                   /protein_id="ACF50165.1"
FT                   /translation="MDGPTSCRCRPLSYPYPLVVFDLDGTLVDSAADIAEALNRTLEDI
FT                   GVARVPETTVLGWIGDGVRRLVEQAVHAAGREVDLAEVMPVFMVHYRECLLRSPRLFDG
FT                   VAEALARLRARNVPLAICTNKPEALVPPLLQHLGIGDAFALVLGGDSLPQRKPSGEPLR
FT                   HMAAHFGLPVEACLMVGDSLTDYRAAEDAGMPIALVRYGYPRGLDLATAHAVAVIDDLR
FT                   ELPGLKG"
     MDGPTSCRCR PLSYPYPLVV FDLDGTLVDS AADIAEALNR TLEDIGVARV PETTVLGWIG        60
     DGVRRLVEQA VHAAGREVDL AEVMPVFMVH YRECLLRSPR LFDGVAEALA RLRARNVPLA       120
     ICTNKPEALV PPLLQHLGIG DAFALVLGGD SLPQRKPSGE PLRHMAAHFG LPVEACLMVG       180
     DSLTDYRAAE DAGMPIALVR YGYPRGLDLA TAHAVAVIDD LRELPGLKG                   229
//

If you have problems or comments...

PBIL Back to PBIL home page