(data stored in ACNUC7421 zone)

EMBL: CP001111.PE461

CP001111.PE461       Location/Qualifiers
FT   CDS             complement(540306..542147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0461"
FT                   /product="TonB-dependent vitamin B12 receptor"
FT                   /note="TIGRFAM: TonB-dependent vitamin B12 receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor plug;
FT                   KEGG: xcb:XC_1091 outer membrane receptor for transport of
FT                   vitamin B"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50166"
FT                   /db_xref="GOA:B4SIG1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010101"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIG1"
FT                   /protein_id="ACF50166.1"
FT                   /translation="MKLQSRMLSLAVLAALPALAQAADDTTALDQILVTATRTPIALQY
FT                   SIAPAQVIDRAQIESSQATSLQELLRGRAGINLTNAGGLGKQSSLFLRGTNSGHTVVLV
FT                   DGVRINSADLGLAMYQDLPLAQIERVEIVRGPQSSLYGADAIGGVIQIFTRRNQGDFAP
FT                   HFQLGGGSNGLREASGGIGGGTERGWFGADIAYQHSDGIDACRGSATLFAGCFADEPDR
FT                   DGYRNLSKSLRGGYSFNDQWNVEGSALRADGKNHYDGYYNYSETRQQVLAGKVRYTPSE
FT                   RLAFTANVGRSDNESDNFGAPGVFGSAQTHRDSASLQGDITLAEGQLLSTGVDWSEDNL
FT                   DGSSAGYLVDSRRNTGVFVQYQGRFGRHQLQVSARNDDNQQFGNHATGSVGWAMELEHG
FT                   LRVNASYGTAFKAPTFSDLYDPWSGVPTLNPEKSKSANLGVSQHGKGWHWGLDVYETRI
FT                   DDLITYDASTMKMQQVEKARIRGAELTGGVLLAGFDINAQLSYTDPRNRTHGSTQFDNW
FT                   LPRRAQQTARLDIDRRFGDFRAGLTVQGAGKRYDDAANAVKVGGYGTLDLRAEYALTPE
FT                   WSLLARAANVFDRRYETVAWFNQPGREYQLSVRYQPK"
     MKLQSRMLSL AVLAALPALA QAADDTTALD QILVTATRTP IALQYSIAPA QVIDRAQIES        60
     SQATSLQELL RGRAGINLTN AGGLGKQSSL FLRGTNSGHT VVLVDGVRIN SADLGLAMYQ       120
     DLPLAQIERV EIVRGPQSSL YGADAIGGVI QIFTRRNQGD FAPHFQLGGG SNGLREASGG       180
     IGGGTERGWF GADIAYQHSD GIDACRGSAT LFAGCFADEP DRDGYRNLSK SLRGGYSFND       240
     QWNVEGSALR ADGKNHYDGY YNYSETRQQV LAGKVRYTPS ERLAFTANVG RSDNESDNFG       300
     APGVFGSAQT HRDSASLQGD ITLAEGQLLS TGVDWSEDNL DGSSAGYLVD SRRNTGVFVQ       360
     YQGRFGRHQL QVSARNDDNQ QFGNHATGSV GWAMELEHGL RVNASYGTAF KAPTFSDLYD       420
     PWSGVPTLNP EKSKSANLGV SQHGKGWHWG LDVYETRIDD LITYDASTMK MQQVEKARIR       480
     GAELTGGVLL AGFDINAQLS YTDPRNRTHG STQFDNWLPR RAQQTARLDI DRRFGDFRAG       540
     LTVQGAGKRY DDAANAVKVG GYGTLDLRAE YALTPEWSLL ARAANVFDRR YETVAWFNQP       600
     GREYQLSVRY QPK                                                          613
//

If you have problems or comments...

PBIL Back to PBIL home page