(data stored in ACNUC7421 zone)

EMBL: CP001111.PE464

CP001111.PE464       Location/Qualifiers
FT   CDS             complement(543641..544123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0464"
FT                   /product="putative GAF sensor protein"
FT                   /note="PFAM: GAF domain protein; KEGG: xom:XOO_0696
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50169"
FT                   /db_xref="InterPro:IPR000614"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIG4"
FT                   /protein_id="ACF50169.1"
FT                   /translation="MFANASLTGSKPEQYAQLLEQARGLVYAESDRIANAANLSALVYH
FT                   ALPDLNWVGFYLYDGKELVVGPFQGLPACVRIPLDKGVCGAAASQRVTQRVDDVDAFPG
FT                   HIACDSASRSELVVPLLRGDELIGVFDIDSPKVGRFDADDQAGLEAIARVFVEALG"
     MFANASLTGS KPEQYAQLLE QARGLVYAES DRIANAANLS ALVYHALPDL NWVGFYLYDG        60
     KELVVGPFQG LPACVRIPLD KGVCGAAASQ RVTQRVDDVD AFPGHIACDS ASRSELVVPL       120
     LRGDELIGVF DIDSPKVGRF DADDQAGLEA IARVFVEALG                             160
//

If you have problems or comments...

PBIL Back to PBIL home page