(data stored in ACNUC7421 zone)

EMBL: CP001111.PE467

CP001111.PE467       Location/Qualifiers
FT   CDS             complement(546609..547346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0467"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="TIGRFAM: peptide methionine sulfoxide reductase;
FT                   PFAM: Methionine sulfoxide reductase A; KEGG: dac:Daci_3068
FT                   peptide methionine sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50172"
FT                   /db_xref="GOA:B4SIG7"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIG7"
FT                   /protein_id="ACF50172.1"
FT                   /translation="MKLSFEQGIAAGVAGLVATALIAGVLLVDHGAVAAPLEASAQAKA
FT                   LPAPSGDAAFRDDATHASVVFAGGCFWGVQGVFQHVKGVSNAVSGYIGGSAANARYERV
FT                   SSGQTGHAEAVKIDYDPRQVSYGQLMQVFFSVVHDPTQLNRQGPDQGSQYRSAIFSDDA
FT                   RQQAASRAYIAQLGQAGSYRAPIVTQLGSGQRFYPAESYHQNYMTNYPQAAYIRYYDAP
FT                   KLAALGKQFPALYRREAVLVPMR"
     MKLSFEQGIA AGVAGLVATA LIAGVLLVDH GAVAAPLEAS AQAKALPAPS GDAAFRDDAT        60
     HASVVFAGGC FWGVQGVFQH VKGVSNAVSG YIGGSAANAR YERVSSGQTG HAEAVKIDYD       120
     PRQVSYGQLM QVFFSVVHDP TQLNRQGPDQ GSQYRSAIFS DDARQQAASR AYIAQLGQAG       180
     SYRAPIVTQL GSGQRFYPAE SYHQNYMTNY PQAAYIRYYD APKLAALGKQ FPALYRREAV       240
     LVPMR                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page