(data stored in ACNUC7421 zone)

EMBL: CP001111.PE468

CP001111.PE468       Location/Qualifiers
FT   CDS             complement(547361..549130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0468"
FT                   /product="cytochrome c biogenesis protein transmembrane
FT                   region"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; cytochrome c biogenesis protein
FT                   transmembrane region; Redoxin domain protein; KEGG:
FT                   rme:Rmet_1170 cytochrome c biogenesis protein,
FT                   transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50173"
FT                   /db_xref="GOA:B4SIG8"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041017"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIG8"
FT                   /protein_id="ACF50173.1"
FT                   /translation="MLLLLLAYLGGALTLLSPCILPVLPFVFARADRPFLRSTLPLLLG
FT                   MALTFTVVASLAAVGSQWVAQANQVGRWIALLLMALFAVALLWPRLADHLLAPFQRVGA
FT                   RLSARADAADAAGRGGAWTSLLIGVATGLLWAPCAGPILGLVLTGAALHGASVGTSSLL
FT                   LAYALGAITALALAVWVGGRVFRALQARLGLGDVLRKVLGVAALLAVVAIGLGWDTGLL
FT                   TRLSTVSTARIEQNLLDAVPGAQPAAPPMMMMAGANAGADAPLPVEGTLPALDGATGWL
FT                   NSPPLSAQQLRGKVVLVDFWTYSCINCLRAMPFVHEWERRYRDHGLVVIGVHTPEFAFE
FT                   RNPSNVMKAVQELKVEYPVALDNQYTIWRAFNNRYWPAQYFVDAQGNIRGHQFGEGNYA
FT                   RSEQVIRRLLTEAGQTNLPPPADPAAADLKGVAVQADMSNLRSPETYLGHARAEQFASP
FT                   GGQRSDSPFDYTLPTTLALNQWGLSGRWTVTDEAAQLQQAGGRIAFQFHARDLHLVLAP
FT                   SQDGTPVRFRVWLDGKPLTAADAGSDVGADGSGVVNEHRLYQLVRQRGTVGPHRFEIEF
FT                   LDTGVQAYAFTFG"
     MLLLLLAYLG GALTLLSPCI LPVLPFVFAR ADRPFLRSTL PLLLGMALTF TVVASLAAVG        60
     SQWVAQANQV GRWIALLLMA LFAVALLWPR LADHLLAPFQ RVGARLSARA DAADAAGRGG       120
     AWTSLLIGVA TGLLWAPCAG PILGLVLTGA ALHGASVGTS SLLLAYALGA ITALALAVWV       180
     GGRVFRALQA RLGLGDVLRK VLGVAALLAV VAIGLGWDTG LLTRLSTVST ARIEQNLLDA       240
     VPGAQPAAPP MMMMAGANAG ADAPLPVEGT LPALDGATGW LNSPPLSAQQ LRGKVVLVDF       300
     WTYSCINCLR AMPFVHEWER RYRDHGLVVI GVHTPEFAFE RNPSNVMKAV QELKVEYPVA       360
     LDNQYTIWRA FNNRYWPAQY FVDAQGNIRG HQFGEGNYAR SEQVIRRLLT EAGQTNLPPP       420
     ADPAAADLKG VAVQADMSNL RSPETYLGHA RAEQFASPGG QRSDSPFDYT LPTTLALNQW       480
     GLSGRWTVTD EAAQLQQAGG RIAFQFHARD LHLVLAPSQD GTPVRFRVWL DGKPLTAADA       540
     GSDVGADGSG VVNEHRLYQL VRQRGTVGPH RFEIEFLDTG VQAYAFTFG                   589
//

If you have problems or comments...

PBIL Back to PBIL home page