(data stored in ACNUC7421 zone)

EMBL: CP001111.PE47

CP001111.PE47        Location/Qualifiers
FT   CDS             complement(55261..55881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0047"
FT                   /product="Thymidine kinase"
FT                   /EC_number="2.7.1.21"
FT                   /note="PFAM: thymidine kinase; KEGG: xac:XAC4282 thymidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49752"
FT                   /db_xref="GOA:B4SRN2"
FT                   /db_xref="InterPro:IPR001267"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRN2"
FT                   /protein_id="ACF49752.1"
FT                   /translation="MAKLYFYYSAMNAGKTTTLLQSAHNYRERGMRVAILTPRLDDRAG
FT                   AGVVASRIGLRADGMAFDRDTDLQRWVEHDLATNGPMGCVLVDEAQFLTRAQVWQLSEI
FT                   VDQLRIPVLCYGLRTDFRGELFEGSQYLLAWADEMQEIKTICHSGKKATMTVRVDEHGR
FT                   AVQDGPQVEIGGNDRYVSVSRAEFKKITRGEGRIDPAQAPLPL"
     MAKLYFYYSA MNAGKTTTLL QSAHNYRERG MRVAILTPRL DDRAGAGVVA SRIGLRADGM        60
     AFDRDTDLQR WVEHDLATNG PMGCVLVDEA QFLTRAQVWQ LSEIVDQLRI PVLCYGLRTD       120
     FRGELFEGSQ YLLAWADEMQ EIKTICHSGK KATMTVRVDE HGRAVQDGPQ VEIGGNDRYV       180
     SVSRAEFKKI TRGEGRIDPA QAPLPL                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page