(data stored in ACNUC7421 zone)

EMBL: CP001111.PE473

CP001111.PE473       Location/Qualifiers
FT   CDS             complement(553375..554064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0473"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: cvi:CV_0761 probable
FT                   two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50178"
FT                   /db_xref="GOA:B4SIH3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B4SIH3"
FT                   /protein_id="ACF50178.1"
FT                   /translation="MLDIVLVEDDARLGTMVSDYLQRHGYQVAHERSGERAVARILAEK
FT                   PALVLLDVGLPDQDGFEVCRQIRPHYDGIICVLTARTDNIDQVLGLELGADDYIGKPIE
FT                   PRVLLARLRAHLRRHRRVEPRDGSLRFGELNIDPSTRNVHLQGSLLELTTAEFDLLFLL
FT                   ASNAGQILDRDALLRGLRGIAFDGLDRSIDARISRLRRKLGDNPEQPERIKTVRGRGYL
FT                   FSRSAWG"
     MLDIVLVEDD ARLGTMVSDY LQRHGYQVAH ERSGERAVAR ILAEKPALVL LDVGLPDQDG        60
     FEVCRQIRPH YDGIICVLTA RTDNIDQVLG LELGADDYIG KPIEPRVLLA RLRAHLRRHR       120
     RVEPRDGSLR FGELNIDPST RNVHLQGSLL ELTTAEFDLL FLLASNAGQI LDRDALLRGL       180
     RGIAFDGLDR SIDARISRLR RKLGDNPEQP ERIKTVRGRG YLFSRSAWG                   229
//

If you have problems or comments...

PBIL Back to PBIL home page